PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0046s0430.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 164aa    MW: 17898.9 Da    PI: 10.5778
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0046s0430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.12.9e-361170362
                  zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ++ l+cprC+st tkfC ynny+lsqPr+fCk+CrryWt+GG+lr+vPvGgg+rkn k+s
  SapurV1A.0046s0430.1.p 11 TEPLPCPRCNSTTTKFCNYNNYNLSQPRHFCKSCRRYWTQGGTLRDVPVGGGTRKNSKRS 70
                            67899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-231262IPR003851Zinc finger, Dof-type
PfamPF027013.5E-311368IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.1361468IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101652IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
METTHHPAKT TEPLPCPRCN STTTKFCNYN NYNLSQPRHF CKSCRRYWTQ GGTLRDVPVG  60
GGTRKNSKRS RSTSNNSPSM STSSSNSTSL NSAPLTAFTT THEPESMPMV LPSTIDSGLA  120
GVKTEVLAGL ENKWRRFDEP GTFRNARNGS RGVPARISGT DRN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006375014.12e-60hypothetical protein POPTR_0014s03590g
TrEMBLB9MVJ02e-60B9MVJ0_POPTR; Uncharacterized protein
STRINGPOPTR_0014s03590.15e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.12e-32Dof family protein